Recombinant Human RNF14 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RNF14-2948H
Product Overview : RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899648) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Molecular Mass : 53.8 kDa
AA Sequence : Tags(s)XCRQKIEKLRRMNCWPWQVFTMEMNLEKQSLSKVEKPGSIWICHRISRYL*AAIQMSVSRIVALNTPFAFCLHLC*TLNCHQIIHPLPHLHSHLVANGCHQLSYLLYAST*TTYGKNTVAAWSCLPGCNFLRKRP*HT*ILSLLLSSRLVLRKKCREGQLKLLPTQS*ILEELLDLM*TKRKLWMREQCRMWNHCQI*SRKSWTLIKLSR*NALIVNCSCAVSVSVRSWVVNACTSWSAGMCTAKPV*RTTLKSRSEMARFNASTAQNQSALRWPLLVRSKS*WKQSYLPVMTAFSSSPPWT*WQMWCTAPGRAASCL*CRNLAAPWVSAPAAILPSVLCAG*PTMGSPHVR*LQRN*WTYEMNTCKRMRLIKDFWIKGMVRE*FRRHWKRWKVRSG*RRTQRAAHVVELP*RN*TDVTR*HVLAVCNISVGFAWVLSLEQTLTNISMTLVHHVLTGCFMLWMLTTIFGKMR*KTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RNF14 ring finger protein 14 [ Homo sapiens (human) ]
Official Symbol RNF14
Synonyms RNF14; ring finger protein 14; E3 ubiquitin-protein ligase RNF14; ARA54; HFB30; TRIAD2; androgen receptor associated protein 54; androgen receptor-associated protein 54; HRIHFB2038; FLJ26004;
Gene ID 9604
mRNA Refseq NM_183401
Protein Refseq NP_899648
MIM 605675
UniProt ID Q9UBS8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RNF14 Products

Required fields are marked with *

My Review for All RNF14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon