Recombinant Human RNASEL protein, His-SUMO-tagged

• Cat.No.: RNASEL-3815H
• Product Overview: Recombinant Human RNASEL protein(Q05823)(330-741aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 330-741aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 63.4 kDa
• AA Sequence: HPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RNASEL ribonuclease L (2,5-oligoisoadenylate synthetase-dependent) [ Homo sapiens ]
• Official Symbol: RNASEL
• Synonyms: RNASEL; ribonuclease L (2,5-oligoisoadenylate synthetase-dependent); PRCA1, prostate cancer 1 , RNS4; 2-5A-dependent ribonuclease; RNase L; ribonuclease 4; 2-5A-dependent RNase; interferon-induced 2-5A-dependent RNase; 2,5-oligoisoadenylate synthetase-dependent; RNS4; PRCA1; MGC104972; MGC133329; DKFZp781D08126
• Gene ID: 6041
• mRNA Refseq: NM_021133
• Protein Refseq: NP_066956
• MIM: 180435
• UniProt ID: Q05823