Recombinant Human RHOJ Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RHOJ-4525H
• Product Overview: RHOJ MS Standard C13 and N15-labeled recombinant protein (NP_065714) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis.
• Molecular Mass: 23.8 kDa
• AA Sequence: MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSIITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RHOJ ras homolog family member J [ Homo sapiens (human) ]
• Official Symbol: RHOJ
• Synonyms: RHOJ; ras homolog family member J; ARHJ, ras homolog gene family, member J, RAS like, family 7, member B, RASL7B; rho-related GTP-binding protein RhoJ; FLJ14445; TCL; TC10-like Rho GTPase; RAS-like, family 7, member B; tc10-like GTP-binding protein; ras homolog gene family, member J; ras-like protein family member 7B; ARHJ; TC10B; RASL7B; MGC34777
• Gene ID: 57381
• mRNA Refseq: NM_020663
• Protein Refseq: NP_065714
• MIM: 607653
• UniProt ID: Q9H4E5