Recombinant Human RHD, His-tagged

• Cat.No.: RHD-31323TH
• Product Overview: Recombinant fragment: ITLFSIRLAT MSALSVLISV DAVLGKVNLA QLVVMVLVEV TALGNLRMVI SNIFNTDY, corresponding to amino acids 108-165 of human RhD fused to a His tag at N-terminal end, 13kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 108-165 a.a.
• Description: The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene, which encodes the RhD protein, and a second gene that encodes both the RhC and RhE antigens on a single polypeptide. The two genes, and a third unrelated gene, are found in a cluster on chromosome 1. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Multiple transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Tissue specificity: Restricted to tissues or cell lines expressing erythroid characters.
• Form: Liquid
• Storage buffer: Preservative: NoneConstituents: PBS
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: ITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTALGNLRMVISNIFNTDY
• Sequence Similarities: Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.

Gene Information

• Gene Name: RHD Rh blood group, D antigen [ Homo sapiens ]
• Official Symbol: RHD
• Synonyms: RHD; Rh blood group, D antigen; RH, Rhesus blood group, D antigen; blood group Rh(D) polypeptide; CD240D; DIIIc; Rh4; Rh30a; RhII; RhPI
• Gene ID: 6007
• mRNA Refseq: NM_001127691
• Protein Refseq: NP_001121163
• MIM: 111680
• Uniprot ID: Q02161
• Chromosome Location: 1p36.11