Recombinant Human RGS19, His-tagged

• Cat.No.: RGS19-30744TH
• Product Overview: Recombinant full length Human RGS19 with an N terminal His tag; 237 amino acids with tag, Predicted MWt 26.7 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 217 amino acids
• Description: G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 26.700kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA

Gene Information

• Gene Name: RGS19 regulator of G-protein signaling 19 [ Homo sapiens ]
• Official Symbol: RGS19
• Synonyms: RGS19; regulator of G-protein signaling 19; regulator of G protein signalling 19; GAIP; RGSGAIP
• Gene ID: 10287
• mRNA Refseq: NM_005873
• Protein Refseq: NP_005864
• MIM: 605071
• Uniprot ID: P49795
• Chromosome Location: 20q13.33
• Pathway: Calcium Regulation in the Cardiac Cell, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; G alpha (z) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem
• Function: G-protein alpha-subunit binding; GTPase activator activity; protein binding; signal transducer activity