Recombinant Human RFC4 protein, GST-tagged

Cat.No. : RFC4-301109H
Product Overview : Recombinant Human RFC4 (1-204 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Cys363
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name RFC4 replication factor C (activator 1) 4, 37kDa [ Homo sapiens ]
Official Symbol RFC4
Synonyms RFC4; replication factor C (activator 1) 4, 37kDa; replication factor C (activator 1) 4 (37kD); replication factor C subunit 4; A1; A1 37 kDa subunit; activator 1 37 kDa subunit; RFC 37 kDa subunit; RFC37; RF-C 37 kDa subunit; activator 1 subunit 4; replication factor C 37 kDa subunit; MGC27291;
Gene ID 5984
mRNA Refseq NM_002916
Protein Refseq NP_002907
MIM 102577
UniProt ID P35249

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RFC4 Products

Required fields are marked with *

My Review for All RFC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon