Recombinant Human REXO2 Protein, GST-tagged

• Cat.No.: REXO2-4033H
• Product Overview: Human DKFZP566E144 full-length ORF ( AAH03502, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradation. It may also be involved in resistance of human cells to UV-C-induced cell death through its role in the DNA repair process. [provided by RefSeq, Nov 2011]
• Molecular Mass: 34.43 kDa
• AA Sequence: MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: REXO2 REX2, RNA exonuclease 2 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: REXO2
• Synonyms: REXO2; REX2, RNA exonuclease 2 homolog (S. cerevisiae); oligoribonuclease, mitochondrial; CGI 114; DKFZP566E144; SFN; small fragment nuclease; RNA exonuclease 2 homolog; RFN; REX2; CGI-114; MGC111570; DKFZp566E144
• Gene ID: 25996
• mRNA Refseq: NM_015523
• Protein Refseq: NP_056338
• MIM: 607149
• UniProt ID: Q9Y3B8