Recombinant Human RETNLB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RETNLB-5569H
Product Overview : RETNLB MS Standard C13 and N15-labeled recombinant protein (NP_115968) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Probable hormone.
Molecular Mass : 11.7 kDa
AA Sequence : MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RETNLB resistin like beta [ Homo sapiens (human) ]
Official Symbol RETNLB
Synonyms RETNLB; resistin like beta; resistin-like beta; FIZZ2; HXCP2; RELMb; found in inflammatory zone 1; colon carcinoma-related gene protein; cysteine-rich secreted protein FIZZ2; cysteine-rich secreted A12-alpha-like protein 1; cysteine-rich secreted protein A12-alpha-like 1; colon and small intestine-specific cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 2; XCP2; FIZZ1; RELMbeta; RELM-beta;
Gene ID 84666
mRNA Refseq NM_032579
Protein Refseq NP_115968
MIM 605645
UniProt ID Q9BQ08

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RETNLB Products

Required fields are marked with *

My Review for All RETNLB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon