Recombinant Human RETNLB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RETNLB-5569H
• Product Overview: RETNLB MS Standard C13 and N15-labeled recombinant protein (NP_115968) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Probable hormone.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.7 kDa
• AA Sequence: MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RETNLB resistin like beta [ Homo sapiens (human) ]
• Official Symbol: RETNLB
• Synonyms: RETNLB; resistin like beta; resistin-like beta; FIZZ2; HXCP2; RELMb; found in inflammatory zone 1; colon carcinoma-related gene protein; cysteine-rich secreted protein FIZZ2; cysteine-rich secreted A12-alpha-like protein 1; cysteine-rich secreted protein A12-alpha-like 1; colon and small intestine-specific cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 2; XCP2; FIZZ1; RELMbeta; RELM-beta
• Gene ID: 84666
• mRNA Refseq: NM_032579
• Protein Refseq: NP_115968
• MIM: 605645
• UniProt ID: Q9BQ08