Recombinant Human RETNLB Protein

Cat.No. : RETNLB-237H
Product Overview : Recombinant Human RETNLB Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Resistin-like molecule-beta (RELM-β) is a member of the RELM family of secreted proteins containing conserved C-terminus cysteines. The RELM family consists of Resistin (FIZZ3), RELM-α (FIZZ1), RELM-β (FIZZ2), and RELM (FIZZ4). Resistin and RELM-β are the only RELM family members found in humans, whereas all four RELM family members are present in rodents. RELM-β functions to increase fibroblast proliferation and differentiation, resulting in airway remodelling and increased inflammation.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Noncovalent Homodimer, 9.5/19.0 kDa (89/178 aa)
AA Sequence : MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥90%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name RETNLB resistin like beta [ Homo sapiens (human) ]
Official Symbol RETNLB
Synonyms RETNLB; resistin like beta; resistin-like beta; FIZZ2; HXCP2; RELMb; found in inflammatory zone 1; colon carcinoma-related gene protein; cysteine-rich secreted protein FIZZ2; cysteine-rich secreted A12-alpha-like protein 1; cysteine-rich secreted protein A12-alpha-like 1; colon and small intestine-specific cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 2; XCP2; FIZZ1; RELMbeta; RELM-beta;
Gene ID 84666
mRNA Refseq NM_032579
Protein Refseq NP_115968
MIM 605645
UniProt ID Q2UXL7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RETNLB Products

Required fields are marked with *

My Review for All RETNLB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon