Recombinant Human REG3G Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: REG3G-2705H
• Product Overview: REG3G MS Standard C13 and N15-labeled recombinant protein (NP_940850) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the regenerating islet-derived genes (REG)3 protein family. These proteins are secreted, C-type lectins with a carbohydrate recognition domain and N-terminal signal peptide. The protein encoded by this gene is an antimicrobial lectin with activity against Gram-positive bacteria. Alternative splicing results in multiple transcript variants encoding multiple isoforms.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 19.3 kDa
• AA Sequence: MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: REG3G regenerating islet-derived 3 gamma [ Homo sapiens (human) ]
• Official Symbol: REG3G
• Synonyms: REG3G; regenerating islet-derived 3 gamma; regenerating islet-derived protein 3-gamma; LPPM429; PAP1B; UNQ429; PAP-1B; REG-3-gamma; reg III-gamma; regenerating gene III; pancreatitis-associated protein 1B; pancreatitis-associated protein IB; regenerating islet-derived protein III-gamma; PAPIB; PAP IB; REG-III; MGC118998; MGC118999; MGC119001
• Gene ID: 130120
• mRNA Refseq: NM_198448
• Protein Refseq: NP_940850
• MIM: 609933
• UniProt ID: Q6UW15