Recombinant Human REEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | REEP1-5097H |
Product Overview : | REEP1 MS Standard C13 and N15-labeled recombinant protein (NP_075063) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 22.3 kDa |
AA Sequence : | MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | REEP1 receptor accessory protein 1 [ Homo sapiens (human) ] |
Official Symbol | REEP1 |
Synonyms | REEP1; receptor accessory protein 1; HMN5B; SPG31; Yip2a; C2orf23; receptor expression-enhancing protein 1; spastic paraplegia 31 protein |
Gene ID | 65055 |
mRNA Refseq | NM_022912 |
Protein Refseq | NP_075063 |
MIM | 609139 |
UniProt ID | Q9H902 |
◆ Recombinant Proteins | ||
Reep1-5449M | Recombinant Mouse Reep1 Protein, Myc/DDK-tagged | +Inquiry |
REEP1-14059M | Recombinant Mouse REEP1 Protein | +Inquiry |
REEP1-7515M | Recombinant Mouse REEP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
REEP1-2246H | Recombinant Human REEP1, GST-tagged | +Inquiry |
RFL6418HF | Recombinant Full Length Human Receptor Expression-Enhancing Protein 1(Reep1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REEP1-2429HCL | Recombinant Human REEP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All REEP1 Products
Required fields are marked with *
My Review for All REEP1 Products
Required fields are marked with *
0
Inquiry Basket