Recombinant Human REDD1 protein

Cat.No. : REDD1-2245H
Product Overview : Recombinant Human REDD1 (1 - 232 aa) was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1 - 232 aa
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Molecular Mass : 51 kDa
AA Sequence : MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDTAYLDG VSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVC VEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSE QLLIEEC
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name DDIT4 DNA-damage-inducible transcript 4 [ Homo sapiens ]
Official Symbol DDIT4
Synonyms DDIT4; DNA-damage-inducible transcript 4; DNA damage-inducible transcript 4 protein; Dig2; FLJ20500; HIF 1 responsive RTP801; REDD 1; REDD1; RTP801; HIF-1 responsive protein RTP801; HIF-1 responsive RTP801 (RTP801); protein regulated in development and DNA damage response 1; REDD-1; RP11-442H21.1;
Gene ID 54541
mRNA Refseq NM_019058
Protein Refseq NP_061931
MIM 607729
UniProt ID Q9NX09
Chromosome Location 10q22.1
Pathway Direct p53 effectors, organism-specific biosystem; mTOR signaling pathway, organism-specific biosystem; mTOR signaling pathway, organism-specific biosystem; mTOR signaling pathway, conserved biosystem;
Function 14-3-3 protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DDIT4 Products

Required fields are marked with *

My Review for All DDIT4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon