Recombinant Human REDD1 protein

• Cat.No.: REDD1-2245H
• Product Overview: Recombinant Human REDD1 (1 - 232 aa) was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
• Molecular Mass: 51 kDa
• Protein length: 1 - 232 aa
• AA Sequence: MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDTAYLDG VSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVC VEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSE QLLIEEC
• Stability: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: DDIT4 DNA-damage-inducible transcript 4 [ Homo sapiens ]
• Official Symbol: DDIT4
• Synonyms: DDIT4; DNA-damage-inducible transcript 4; DNA damage-inducible transcript 4 protein; Dig2; FLJ20500; HIF 1 responsive RTP801; REDD 1; REDD1; RTP801; HIF-1 responsive protein RTP801; HIF-1 responsive RTP801 (RTP801); protein regulated in development and DNA damage response 1; REDD-1; RP11-442H21.1
• Gene ID: 54541
• mRNA Refseq: NM_019058
• Protein Refseq: NP_061931
• MIM: 607729
• UniProt ID: Q9NX09
• Chromosome Location: 10q22.1
• Pathway: Direct p53 effectors, organism-specific biosystem; mTOR signaling pathway, organism-specific biosystem; mTOR signaling pathway, organism-specific biosystem; mTOR signaling pathway, conserved biosystem
• Function: 14-3-3 protein binding