Recombinant Human RDX protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	N-GST
Protein length :	384-455 aa
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence :	EEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQED
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	RDX radixin [ Homo sapiens ]
Official Symbol	RDX
Synonyms	RDX; radixin; deafness, autosomal recessive 24 , DFNB24; DFNB24;
Gene ID	5962
mRNA Refseq	NM_002906
Protein Refseq	NP_002897
MIM	179410
UniProt ID	P35241