Recombinant Human RDRC protein, His-tagged
Cat.No. : | RDRC-3451H |
Product Overview : | Recombinant Human RDRC protein(436-541 aa), fused to His tag, was expressed in E. coli. |
Availability | February 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 436-541 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPLPTEEGNPLLKHYRGPAGDATVASEKESVM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
◆ Recombinant Proteins | ||
UGDH-17800M | Recombinant Mouse UGDH Protein | +Inquiry |
FAF1-3647H | Recombinant Human FAF1 Protein, GST-tagged | +Inquiry |
MRC2-3406R | Recombinant Rat MRC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLAMF6-241H | Active Recombinant Human SLAMF6 protein, His-tagged | +Inquiry |
FNDC8-528C | Recombinant Cynomolgus FNDC8 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGA-80H | Active Native Human Fibrinogen (plasminogen depleted) | +Inquiry |
Hp-8155M | Native Mouse Serum Haptoglobin | +Inquiry |
LOC102577615-59P | Native potato LOC102577615 Protein | +Inquiry |
TF-321H | Native Human Transferrin Rhodamine | +Inquiry |
KLC-212H | Native Human Kappa Light Chain | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOTCH1-469MCL | Recombinant Mouse NOTCH1 cell lysate | +Inquiry |
CYB561D2-7147HCL | Recombinant Human CYB561D2 293 Cell Lysate | +Inquiry |
VCAN-413HCL | Recombinant Human VCAN cell lysate | +Inquiry |
C3orf37-8046HCL | Recombinant Human C3orf37 293 Cell Lysate | +Inquiry |
FUBP3-675HCL | Recombinant Human FUBP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RDRC Products
Required fields are marked with *
My Review for All RDRC Products
Required fields are marked with *
0
Inquiry Basket