Recombinant Human RCN1 Protein (31-331 aa), His-tagged

• Cat.No.: RCN1-1654H
• Product Overview: Recombinant Human RCN1 Protein (31-331 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 31-331 aa
• Description: May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 37.7 kDa
• AA Sequence: PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: RCN1 reticulocalbin 1, EF-hand calcium binding domain [ Homo sapiens ]
• Official Symbol: RCN1
• Synonyms: RCN1; RCN; reticulocalbin-1; FLJ37041; PIG20; Rcal; RCAL; FLJ55835
• Gene ID: 5954
• mRNA Refseq: NM_002901
• Protein Refseq: NP_002892
• MIM: 602735
• UniProt ID: Q15293