Recombinant Human RBPJ protein(91-170 aa), C-His-tagged

• Cat.No.: RBPJ-2829H
• Product Overview: Recombinant Human RBPJ protein(Q06330)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 91-170 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: GCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKK
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: RBPJ recombination signal binding protein for immunoglobulin kappa J region [ Homo sapiens ]
• Official Symbol: RBPJ
• Synonyms: RBPJ; recombination signal binding protein for immunoglobulin kappa J region; IGKJRB1, RBPSUH, recombining binding protein suppressor of hairless (Drosophila); recombining binding protein suppressor of hairless; CBF1; IGKJRB; KBF2; RBP J; RBPJK; SUH; suppressor of hairless homolog (Drosophila); CBF-1; RBP-JK; RBP-J kappa; H-2K binding factor-2; suppressor of hairless homolog; renal carcinoma antigen NY-REN-30; immunoglobulin kappa J region recombination signal binding protein 1; csl; RBP-J; RBPSUH; IGKJRB1; MGC61669
• Gene ID: 3516
• mRNA Refseq: NM_005349
• Protein Refseq: NP_005340
• MIM: 147183
• UniProt ID: Q06330