Recombinant Human RBP7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RBP7-4968H
• Product Overview: RBP7 MS Standard C13 and N15-labeled recombinant protein (NP_443192) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs.
• Molecular Mass: 15.5 kDa
• AA Sequence: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RBP7 retinol binding protein 7 [ Homo sapiens (human) ]
• Official Symbol: RBP7
• Synonyms: RBP7; retinol binding protein 7, cellular; retinoid-binding protein 7; CRBPIV; CRABP4; CRABP-IV; retinoid binding protein 7; cellular retinoic acid-binding protein 4; cellular retinoic acid-binding protein IV; putative cellular retinol-binding protein CRBP IV; CRBP4; MGC70641
• Gene ID: 116362
• mRNA Refseq: NM_052960
• Protein Refseq: NP_443192
• MIM: 608604
• UniProt ID: Q96R05