Recombinant Human RBP7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RBP7-4968H
Product Overview : RBP7 MS Standard C13 and N15-labeled recombinant protein (NP_443192) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs.
Molecular Mass : 15.5 kDa
AA Sequence : MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RBP7 retinol binding protein 7 [ Homo sapiens (human) ]
Official Symbol RBP7
Synonyms RBP7; retinol binding protein 7, cellular; retinoid-binding protein 7; CRBPIV; CRABP4; CRABP-IV; retinoid binding protein 7; cellular retinoic acid-binding protein 4; cellular retinoic acid-binding protein IV; putative cellular retinol-binding protein CRBP IV; CRBP4; MGC70641;
Gene ID 116362
mRNA Refseq NM_052960
Protein Refseq NP_443192
MIM 608604
UniProt ID Q96R05

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBP7 Products

Required fields are marked with *

My Review for All RBP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon