Recombinant Human RBP1 protein, GST-tagged

• Cat.No.: RBP1-30186H
• Product Overview: Recombinant Human RBP1 (1-135 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Gln135
• AA Sequence: MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RBP1 retinol binding protein 1, cellular [ Homo sapiens ]
• Official Symbol: RBP1
• Synonyms: RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC; CRBP-I; cellular retinol-binding protein I; retinol-binding protein 1, cellular; CRABP-I
• Gene ID: 5947
• mRNA Refseq: NM_001130992
• Protein Refseq: NP_001124464
• MIM: 180260
• UniProt ID: P09455