Recombinant Human RBP1

Description :	This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length :	135 amino acids
Molecular Weight :	40.920kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPD KEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDD RKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM RVEGVVCKQVFKKVQ
Sequence Similarities :	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Tag :	Non

Gene Name	RBP1 retinol binding protein 1, cellular [ Homo sapiens ]
Official Symbol	RBP1
Synonyms	RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC;
Gene ID	5947
mRNA Refseq	NM_001130992
Protein Refseq	NP_001124464
MIM	180260
Uniprot ID	P09455
Chromosome Location	3q21-q23
Pathway	Retinoic acid receptors-mediated signaling, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem;
Function	lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity;