Recombinant Human RBMX protein(11-90 aa), C-His-tagged

• Cat.No.: RBMX-2745H
• Product Overview: Recombinant Human RBMX protein(P38159)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 11-90 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE

Gene Information

• Gene Name: RBMX RNA binding motif protein, X-linked [ Homo sapiens ]
• Official Symbol: RBMX
• Synonyms: RBMX; RNA binding motif protein, X-linked; RNA binding motif protein, X chromosome; RNA-binding motif protein, X chromosome; heterogeneous nuclear ribonucleoprotein G; hnRNP G; RNMX; glycoprotein p43; HNRPG; RBMXP1; RBMXRT; hnRNP-G
• Gene ID: 27316
• mRNA Refseq: NM_001164803
• Protein Refseq: NP_001158275
• MIM: 300199
• UniProt ID: P38159