Recombinant Human RBL2 protein, His-tagged

Cat.No. : RBL2-4358H
Product Overview : Recombinant Human RBL2 protein(Q08999)(417-616aa), fused to N-terminal His tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 417-616aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 27.4 kDa
AA Sequence : TPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRV
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name RBL2 retinoblastoma-like 2 (p130) [ Homo sapiens ]
Official Symbol RBL2
Synonyms RBL2; retinoblastoma-like 2 (p130); retinoblastoma-like protein 2; p130; Rb2; PRB2; RBR-2; retinoblastoma-related protein 2; 130 kDa retinoblastoma-associated protein; P130; FLJ26459;
Gene ID 5934
mRNA Refseq NM_005611
Protein Refseq NP_005602
MIM 180203
UniProt ID Q08999

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBL2 Products

Required fields are marked with *

My Review for All RBL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon