Recombinant Human RBAKDN Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RBAKDN-543H
• Product Overview: LOC389458 MS Standard C13 and N15-labeled recombinant protein (NP_976327) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: RBAKDN (RBAK Downstream Neighbor) is an RNA Gene, and is affiliated with the lncRNA class.
• Molecular Mass: 12.7 kDa
• AA Sequence: MLTPRKSFRTCSKASGLAETESCGQTHTWPRALAVLMGLWWPRDQKAGEEDLRFRERRPGLQATATGSGEHGAFPVHSQGVWASTHWQGTAVCPLQTPPPDAFIRNNKVLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RBAKDN RBAK downstream neighbor [ Homo sapiens (human) ]
• Official Symbol: RBAKDN
• Synonyms: RBAKDN; RBAK downstream neighbor; MGC35170
• Gene ID: 389458
• mRNA Refseq: NM_203393
• Protein Refseq: NP_976327
• UniProt ID: A6NC62