Recombinant Human RARS protein, His-tagged
Cat.No. : | RARS-3885H |
Product Overview : | Recombinant Human RARS protein(1-190 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-190 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RARS arginyl-tRNA synthetase [ Homo sapiens ] |
Official Symbol | RARS |
Synonyms | RARS; arginyl-tRNA synthetase; arginine--tRNA ligase, cytoplasmic; arginine tRNA ligase 1; cytoplasmic; DALRD1; arginine tRNA ligase 1, cytoplasmic; arginyl-tRNA synthetase, cytoplasmic; ArgRS; MGC8641; |
Gene ID | 5917 |
mRNA Refseq | NM_002887 |
Protein Refseq | NP_002878 |
MIM | 107820 |
UniProt ID | P54136 |
◆ Recombinant Proteins | ||
RARS-13937M | Recombinant Mouse RARS Protein | +Inquiry |
RARS-4929R | Recombinant Rat RARS Protein | +Inquiry |
Rars-3623R | Recombinant Rat Rars, His-tagged | +Inquiry |
RARS-301564H | Recombinant Human RARS protein, GST-tagged | +Inquiry |
RARS-2319C | Recombinant Chicken RARS | +Inquiry |
◆ Cell & Tissue Lysates | ||
RARS-1472HCL | Recombinant Human RARS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RARS Products
Required fields are marked with *
My Review for All RARS Products
Required fields are marked with *
0
Inquiry Basket