Recombinant Human RARRES2

• Cat.No.: RARRES2-27066TH
• Product Overview: Recombinant fragment corresponding to amino acids 21-155 of Human Chemerin; 135 amino acids, MWt 15.6 kDa.

Specification

• Description: This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein.
• Protein length: 135 amino acids
• Molecular Weight: 15.600kDa
• Source: E. coli
• Tissue specificity: Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
• Biological activity: Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml.
• Form: Lyophilised:Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% B
• Purity: by SDS-PAGE
• Storage buffer: Preservative: None
• Storage: The lyophilized protein is stable at room temperature for up to 1 month. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C. Avoid repeated freeze/thaw cycles. See reconstitution notes
• Sequences of amino acids: ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFA
• Tag: Non

Gene Information

• Gene Name: RARRES2 retinoic acid receptor responder (tazarotene induced) 2 [ Homo sapiens ]
• Official Symbol: RARRES2
• Synonyms: RARRES2; retinoic acid receptor responder (tazarotene induced) 2; retinoic acid receptor responder protein 2; chemerin; HP10433; TIG2
• Gene ID: 5919
• mRNA Refseq: NM_002889
• Protein Refseq: NP_002880
• MIM: 601973
• Uniprot ID: Q99969
• Chromosome Location: 7q36.1
• Function: receptor binding