Recombinant Human RAD50 protein, His&Myc-tagged

• Cat.No.: RAD50-5353H
• Product Overview: Recombinant Human RAD50 protein(Q92878)(1-235aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His&C-Myc
• Protein length: 1-235aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.1 kDa
• AASequence: MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: RAD50 RAD50 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RAD50
• Synonyms: RAD50; RAD50 homolog (S. cerevisiae); RAD50 (S. cerevisiae) homolog; DNA repair protein RAD50; hRad50; RAD50 2; NBSLD; RAD502
• Gene ID: 10111
• mRNA Refseq: NM_005732
• Protein Refseq: NP_005723
• MIM: 604040
• UniProt ID: Q92878