Recombinant Human RAC1(Y72C) protein, His-tagged

Cat.No. : RAC1-193H
Product Overview : Recombinant Human RAC1(Y72C) fused with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.
Form : 50mM Tris-HCl, pH 8.0, 200mMNaCl, 20% glycerol.
Molecular Mass : (Theoretical molecular weight)~24kDa including His tag
AA Sequence : MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSCPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP PVKKRKRKCLLL
Purity : > 90% as determined by SDS-PAGE
Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration : 2.0mg/ml
Gene Name RAC1 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) [ Homo sapiens ]
Official Symbol RAC1
Synonyms RAC1; ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); ras-related C3 botulinum toxin substrate 1; p21 Rac1; Rac 1; TC 25; ras-like protein TC25; cell migration-inducing gene 5 protein; MIG5; Rac-1; TC-25; p21-Rac1; MGC111543;
Gene ID 5879
mRNA Refseq NM_006908
Protein Refseq NP_008839
MIM 602048
UniProt ID P63000
Chromosome Location 7p22
Pathway Activation of Rac, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem;
Function GTP binding; GTPase activity; enzyme binding; nucleotide binding; protein binding; thioesterase binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAC1 Products

Required fields are marked with *

My Review for All RAC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon