Recombinant Human RAB8A Protein, C-6×His tagged

• Cat.No.: RAB8A-311H
• Product Overview: Recombinant Human RAB8A Protein with C-6×His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-203 a.a.
• Description: The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.
• Molecular Mass: ~ 24 kDa
• AA Sequence: AKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCHHHHHH
• Endotoxin: < 1 EU/μg (determined by the LAL method)
• Purity: > 85% as determined by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.12 mg/mL
• Storage Buffer: Supplied in PBS buffer, pH 7.4

Gene Information

• Gene Name: RAB8A RAB8A, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB8A
• Synonyms: RAB8A; RAB8A, member RAS oncogene family; MEL; RAB8; ras-related protein Rab-8A; mel transforming oncogene (RAB8 homolog); mel transforming oncogene (derived from cell line NK14); mel transforming oncogene (derived from cell line NK14)- RAB8 homolog; oncogene c-mel; ras-associated protein RAB8; EC 3.6.5.2
• Gene ID: 4218
• mRNA Refseq: NM_005370
• Protein Refseq: NP_005361
• MIM: 165040
• UniProt ID: P24407