Recombinant Human RAB8A

• Cat.No.: RAB8A-29054TH
• Product Overview: Recombinant full length Human RAB8A with N terminal proprietary tag; predicted MWt 48.77 kDa inclusive of tag; P61006, AAH02977.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 207 amino acids
• Description: The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.
• Molecular Weight: 48.770kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFIST IGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRG AMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVEN AFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSS FFRCVLL
• Sequence Similarities: Belongs to the small GTPase superfamily. Rab family.

Gene Information

• Gene Name: RAB8A RAB8A, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB8A
• Synonyms: RAB8A; RAB8A, member RAS oncogene family; MEL, mel transforming oncogene (derived from cell line NK14); ras-related protein Rab-8A; RAB8
• Gene ID: 4218
• mRNA Refseq: NM_005370
• Protein Refseq: NP_005361
• MIM: 165040
• Uniprot ID: P61006
• Chromosome Location: 19p13.2-p13.1
• Pathway: Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem
• Function: GTP binding; nucleotide binding; protein binding