Recombinant Full Length Human RAB5A protein, His-SUMO-tagged

• Cat.No.: RAB5A-3403H
• Product Overview: Recombinant Human RAB5A protein(P20339)(1-215aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-215aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.7 kDa
• AA Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RAB5A RAB5A, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB5A
• Synonyms: RAB5A; RAB5A, member RAS oncogene family; RAB5; ras-related protein Rab-5A; RAS associated protein RAB5A; RAS-associated protein RAB5A
• Gene ID: 5868
• mRNA Refseq: NM_004162
• Protein Refseq: NP_004153
• MIM: 179512
• UniProt ID: P20339