Recombinant Full Length Human RAB5A protein, His-SUMO-tagged
Cat.No. : | RAB5A-3403H |
Product Overview : | Recombinant Human RAB5A protein(P20339)(1-215aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-215aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RAB5A RAB5A, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB5A |
Synonyms | RAB5A; RAB5A, member RAS oncogene family; RAB5; ras-related protein Rab-5A; RAS associated protein RAB5A; RAS-associated protein RAB5A; |
Gene ID | 5868 |
mRNA Refseq | NM_004162 |
Protein Refseq | NP_004153 |
MIM | 179512 |
UniProt ID | P20339 |
◆ Recombinant Proteins | ||
RAB5A-1838H | Recombinant Human RAB5A Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB5A-859HFL | Recombinant Full Length Human RAB5A Protein, C-Flag-tagged | +Inquiry |
RAB5A-1770H | Recombinant Human RAB5A protein, His & T7-tagged | +Inquiry |
RAB5A-301493H | Recombinant Human RAB5A protein, GST-tagged | +Inquiry |
RAB5A-3573R | Recombinant Rhesus Macaque RAB5A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5A-2588HCL | Recombinant Human RAB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB5A Products
Required fields are marked with *
My Review for All RAB5A Products
Required fields are marked with *
0
Inquiry Basket