Recombinant Human RAB3D, His-tagged

• Cat.No.: RAB3D-31275TH
• Product Overview: Recombinant full length Human Rab3D with an N terminal His tag; 239 amino acids with tag, Predicted MWt 26.4 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 219 amino acids
• Description: Ras-related protein Rab-3D, also known as GOV, is a member of the Ras superfamily of small Rab GTPases. Rab proteins play an important role for, either in endocytosis or in biosynthetic protein transport.
• Conjugation: HIS
• Molecular Weight: 26.400kDa inclusive of tags
• Tissue specificity: Highly expressed in granulocytes of peripheral blood. Constitutively expressed at low levels in all hematopoietic cell lines investigated.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
• Sequence Similarities: Belongs to the small GTPase superfamily. Rab family.

Gene Information

• Gene Name: RAB3D RAB3D, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB3D
• Synonyms: RAB3D; RAB3D, member RAS oncogene family; GOV; ras-related protein Rab-3D; D2 2; glioblastoma overexpressed; Rab3D upregulated with myeloid differentiation; RAB16; RAD3D
• Gene ID: 9545
• mRNA Refseq: NM_004283
• Protein Refseq: NP_004274
• MIM: 604350
• Uniprot ID: O95716
• Chromosome Location: 19p13.2
• Pathway: Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem
• Function: GTP binding; GTPase activity; GTPase binding; nucleotide binding