Recombinant Human RAB32, His-tagged
Cat.No. : | RAB32-28750TH |
Product Overview : | Recombinant full length Human RAB32 with N terminal His tag; 249 amino acids with tag, Predicted MWt 27.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 225 amino acids |
Description : | Small GTP-binding proteins of the RAB family, such as RAB32, play essential roles in vesicle and granule targeting (Bao et al. |
Conjugation : | HIS |
Molecular Weight : | 27.600kDa inclusive of tags |
Tissue specificity : | Widely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.08% DTT, 50% Glycerol, 1.17% Sodium chloride, 0.06% EDTA |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMAGGGAGDPGLGAAAA PAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHY RATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRV YYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPN GSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE TSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIK LDQETLRAENKSQCC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
Gene Name | RAB32 RAB32, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB32 |
Synonyms | RAB32; RAB32, member RAS oncogene family; ras-related protein Rab-32; |
Gene ID | 10981 |
mRNA Refseq | NM_006834 |
Protein Refseq | NP_006825 |
MIM | 612906 |
Uniprot ID | Q13637 |
Chromosome Location | 6q24.2 |
Function | GTP binding; nucleotide binding; |
◆ Recombinant Proteins | ||
RAB32-1513H | Recombinant Human RAB32 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB32-28750TH | Recombinant Human RAB32, His-tagged | +Inquiry |
Rab32-5308M | Recombinant Mouse Rab32 Protein, Myc/DDK-tagged | +Inquiry |
RAB32-5049C | Recombinant Chicken RAB32 | +Inquiry |
RAB32-30604TH | Recombinant Human RAB32 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB32-2607HCL | Recombinant Human RAB32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB32 Products
Required fields are marked with *
My Review for All RAB32 Products
Required fields are marked with *
0
Inquiry Basket