Recombinant Human RAB28 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB28-6510H
• Product Overview: RAB28 MS Standard C13 and N15-labeled recombinant protein (NP_001017979) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the Rab subfamily of Ras-related small GTPases. The encoded protein may be involved in regulating intracellular trafficking. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 9 and X.
• Molecular Mass: 24.8 kDa
• AA Sequence: MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCAVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB28 RAB28, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB28
• Synonyms: RAB28; RAB28, member RAS oncogene family; ras-related protein Rab-28; MGC41862
• Gene ID: 9364
• mRNA Refseq: NM_001017979
• Protein Refseq: NP_001017979
• MIM: 612994
• UniProt ID: P51157