Recombinant Human RAB20 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB20-2287H
• Product Overview: RAB20 MS Standard C13 and N15-labeled recombinant protein (NP_060287) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Plays a role in apical endocytosis/recycling. Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in the fusion of phagosomes with lysosomes.
• Molecular Mass: 26.3 kDa
• AA Sequence: MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB20 RAB20, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB20
• Synonyms: RAB20; RAB20, member RAS oncogene family; ras-related protein Rab-20; FLJ20429
• Gene ID: 55647
• mRNA Refseq: NM_017817
• Protein Refseq: NP_060287
• UniProt ID: Q9NX57