Recombinant Human RAB12 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB12-5912H
• Product Overview: RAB12 MS Standard C13 and N15-labeled recombinant protein (NP_001020471) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RAB12 (RAB12, Member RAS Oncogene Family) is a Protein Coding gene. Among its related pathways are RAB GEFs exchange GTP for GDP on RABs and Metabolism of proteins. Gene Ontology (GO) annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is RAB3C.
• Molecular Mass: 27.1 kDa
• AA Sequence: MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB12 RAB12, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB12
• Synonyms: RAB12; RAB12, member RAS oncogene family; ras-related protein Rab-12; putative Ras-related protein Rab-12
• Gene ID: 201475
• mRNA Refseq: NM_001025300
• Protein Refseq: NP_001020471
• MIM: 616448
• UniProt ID: Q6IQ22