Recombinant Human PXMP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PXMP2-735H
• Product Overview: PXMP2 MS Standard C13 and N15-labeled recombinant protein (NP_061133) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.3 kDa
• AA Sequence: MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PXMP2 peroxisomal membrane protein 2 [ Homo sapiens (human) ]
• Official Symbol: PXMP2
• Synonyms: PXMP2; peroxisomal membrane protein 2, 22kDa; peroxisomal membrane protein 2 (22kD); peroxisomal membrane protein 2; PMP22; 22 kDa peroxisomal membrane protein; FLJ54922
• Gene ID: 5827
• mRNA Refseq: NM_018663
• Protein Refseq: NP_061133
• MIM: 617399
• UniProt ID: Q9NR77