Recombinant Human PVRL2 protein, T7/His-tagged

• Cat.No.: PVRL2-40H
• Product Overview: Recombinant human CD112 extracellular domain cDNA (32 - 350 aa, Isoform-a, derived from BC003091) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 32-350 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPAN HQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGM TWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPS GRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTF PTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETP
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro cell receptors interaction for hematopoietic, endothelial differentiation regulations study coating with this protein.2. May be used for protein-protein interaction assay development.3. Potential diagnostic biomarker protein for acute myeloid leukemia.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: PVRL2 poliovirus receptor-related 2 (herpesvirus entry mediator B) [ Homo sapiens ]
• Official Symbol: PVRL2
• Synonyms: PVRL2; poliovirus receptor-related 2 (herpesvirus entry mediator B); HVEB; poliovirus receptor-related protein 2; CD112; PRR2; PVRR2; nectin-2; poliovirus receptor-like 2; herpesvirus entry protein B
• Gene ID: 5819
• mRNA Refseq: NM_001042724
• Protein Refseq: NP_001036189
• MIM: 600798
• UniProt ID: Q92692
• Chromosome Location: 19q13.2-q13.4
• Pathway: Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem
• Function: cell adhesion molecule binding; coreceptor activity; protein binding; protein homodimerization activity; protein homodimerization activity; receptor activity