Recombinant Human PVRL1 protein, T7/His-tagged

• Cat.No.: PVRL1-106H
• Product Overview: Recombinant human CD111 extracellular domain cDNA (31-355aa, Isoform-1, derived from BC104948) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 31-355 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQN VAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEG TQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACI VNYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTLFF KGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAGPVPTA
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro cell receptors interaction for epithelial, endothelial and neuronal differentiation regulations study with this protein as coating matrix protein.2. May be used for CD111 protein-protein interaction assay3. May be used for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: PVRL1 poliovirus receptor-related 1 (herpesvirus entry mediator C) [ Homo sapiens ]
• Official Symbol: PVRL1
• Synonyms: PVRL1; poliovirus receptor-related 1 (herpesvirus entry mediator C); ED4, HVEC; poliovirus receptor-related protein 1; CD111; CLPED1; HIgR; nectin; OFC7; PRR; PRR1; PVRR1; SK 12; nectin 1; poliovirus receptor-like 1; herpesvirus Ig-like receptor; herpes v
• Gene ID: 5818
• mRNA Refseq: NM_002855
• Protein Refseq: NP_002846
• MIM: 600644
• UniProt ID: Q15223
• Chromosome Location: 11q23-q24
• Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem
• Function: carbohydrate binding; cell adhesion molecule binding; coreceptor activity; protein binding; protein heterodimerization activity; protein homodimerization activity; receptor activity; virion binding