Recombinant Human PVR protein, His-SUMO-tagged

• Cat.No.: PVR-3395H
• Product Overview: Recombinant Human PVR protein(P15151)(21-343aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.1 kDa
• Protein length: 21-343aa
• AA Sequence: WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PVR poliovirus receptor [ Homo sapiens ]
• Official Symbol: PVR
• Synonyms: PVR; poliovirus receptor; PVS; CD155; HVED; Necl 5; NECL5; nectin like 5; Tage4; nectin-like 5; nectin-like protein 5; TAGE4; Necl-5; FLJ25946
• Gene ID: 5817
• mRNA Refseq: NM_001135768
• Protein Refseq: NP_001129240
• MIM: 173850
• UniProt ID: P15151