Recombinant Human PTPRJ protein(1001-1330 aa), N-SUMO & N-His-tagged

• Cat.No.: PTPRJ-2838H
• Product Overview: Recombinant Human PTPRJ protein(Q12913)(1001-1330 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1001-1330 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFG

Gene Information

• Gene Name: PTPRJ protein tyrosine phosphatase, receptor type, J [ Homo sapiens ]
• Official Symbol: PTPRJ
• Synonyms: PTPRJ; protein tyrosine phosphatase, receptor type, J; receptor-type tyrosine-protein phosphatase eta; CD148; DEP1; HPTPeta; DEP-1; R-PTP-J; HPTP eta; CD148 antigen; density-enhanced phosphatase 1; protein-tyrosine phosphatase eta; human density enhanced phosphatase-1; protein-tyrosine phosphatase receptor type J; susceptibility to colon cancer 1, mouse, homolog of; protein tyrosine phosphatase, receptor type, J polypeptide; SCC1; R-PTP-ETA
• Gene ID: 5795
• mRNA Refseq: NM_001098503
• Protein Refseq: NP_001091973
• MIM: 600925
• UniProt ID: Q12913