Recombinant Human PTPLAD1 protein, His-tagged

Cat.No. : PTPLAD1-3200H
Product Overview : Recombinant Human PTPLAD1 protein(1-149 aa), fused to His tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-149 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGY
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PTPLAD1 protein tyrosine phosphatase-like A domain containing 1 [ Homo sapiens ]
Official Symbol PTPLAD1
Synonyms PTPLAD1; protein tyrosine phosphatase-like A domain containing 1; 3-hydroxyacyl-CoA dehydratase 3; B ind1; HSPC121; hB-ind1; butyrate-induced protein 1; butyrate-induced transcript 1; protein tyrosine phosphatase-like protein PTPLAD1; protein-tyrosine phosphatase-like A domain-containing protein 1; HACD3; B-IND1; FLJ90376;
Gene ID 51495
mRNA Refseq NM_016395
Protein Refseq NP_057479
UniProt ID Q9P035

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PTPLAD1 Products

Required fields are marked with *

My Review for All PTPLAD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon