Recombinant Human PTN protein, GST-tagged

• Cat.No.: PTN-301230H
• Product Overview: Recombinant Human PTN (94-168 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Gln94-Asp168
• AA Sequence: QFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PTN pleiotrophin [ Homo sapiens ]
• Official Symbol: PTN
• Synonyms: PTN; pleiotrophin; NEGF1, neurite growth promoting factor 1; HBGF8; HBNF; heparin binding growth factor 8; HBBM; OSF-1; HB-GAM; HBGF-8; HBNF-1; osteoblast-specific factor 1; heparin-binding brain mitogen; heparin-binding growth factor 8; heparin affin regulatory protein; neurite growth-promoting factor 1; heparin-binding growth-associated molecule; heparin-binding neurite outgrowth-promoting factor 1; pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1); HARP; NEGF1
• Gene ID: 5764
• mRNA Refseq: NM_002825
• Protein Refseq: NP_002816
• MIM: 162095
• UniProt ID: P21246