Recombinant Human PTN Protein

Cat.No. : PTN-232H
Product Overview : Recombinant Human PTN Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Pleiotrophin (PTN) is a heparin-binding growth factor that has mitogenic effects on fibroblast, epithelial, and endothelial cells. PTN is made by many tissues, but is predominantly secreted by nervous tissue during development. PTN induces neurite outgrowth and is involved in tumor growth and metastasis. PTN binds with low affinity to the cell surface receptor nucleolin to inhibit HIV-1 infection. PNT also binds the receptor protein tyrosine phosphatase type Z (PTPRZ), syndecan-3, and anaplastic lymphoma kinase (ALK) receptors.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 15.4 kDa (137 aa)
AA Sequence : MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name PTN pleiotrophin [ Homo sapiens (human) ]
Official Symbol PTN
Synonyms PTN; pleiotrophin; NEGF1, neurite growth promoting factor 1; HBGF8; HBNF; heparin binding growth factor 8; HBBM; OSF-1; HB-GAM; HBGF-8; HBNF-1; osteoblast-specific factor 1; heparin-binding brain mitogen; heparin-binding growth factor 8; heparin affin regulatory protein; neurite growth-promoting factor 1; heparin-binding growth-associated molecule; heparin-binding neurite outgrowth-promoting factor 1; pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1); HARP; NEGF1;
Gene ID 5764
mRNA Refseq NM_002825
Protein Refseq NP_002816
MIM 162095
UniProt ID P21246

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PTN Products

Required fields are marked with *

My Review for All PTN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon