Recombinant Human PTH2R protein, His-SUMO-tagged

• Cat.No.: PTH2R-3387H
• Product Overview: Recombinant Human PTH2R protein(P49190)(27-145aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 27-145aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.6 kDa
• AA Sequence: DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PTH2R parathyroid hormone 2 receptor [ Homo sapiens ]
• Official Symbol: PTH2R
• Synonyms: PTH2R; parathyroid hormone 2 receptor; parathyroid hormone receptor 2 , PTHR2; PTH2 receptor; parathyroid hormone receptor 2; PTHR2
• Gene ID: 5746
• mRNA Refseq: NM_005048
• Protein Refseq: NP_005039
• MIM: 601469
• UniProt ID: P49190