Recombinant Human PTGIR

• Cat.No.: PTGIR-31205TH
• Product Overview: Recombinant fragment of Human Prostaglandin I2 Receptor (aa 296-386) with N-terminal proprietary tag, 35.64 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 91 amino acids
• Description: The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor.
• Molecular Weight: 35.640kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.

Gene Information

• Gene Name: PTGIR prostaglandin I2 (prostacyclin) receptor (IP) [ Homo sapiens ]
• Official Symbol: PTGIR
• Synonyms: PTGIR; prostaglandin I2 (prostacyclin) receptor (IP); prostacyclin receptor; IP
• Gene ID: 5739
• mRNA Refseq: NM_000960
• Protein Refseq: NP_000951
• MIM: 600022
• Uniprot ID: P43119
• Chromosome Location: 19q13.3
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Eicosanoid ligand-binding receptors, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem
• Function: G-protein coupled receptor activity; guanyl-nucleotide exchange factor activity; receptor activity; signal transducer activity