Recombinant Human PTDSS1 Protein (1-35 aa), GST-tagged

• Cat.No.: PTDSS1-1203H
• Product Overview: Recombinant Human PTDSS1 Protein (1-35 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.

Specification

• Description: Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In mbranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.
• Source: E. coli
• Species: Human
• Tag: GST
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.1 kDa
• Protein length: 1-35 aa
• AA Sequence: MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: PTDSS1 phosphatidylserine synthase 1 [ Homo sapiens ]
• Official Symbol: PTDSS1
• Synonyms: PTDSS1; KIAA0024; PSS1; PSSA; PSS-1
• Gene ID: 9791
• mRNA Refseq: NM_014754
• Protein Refseq: NP_055569
• MIM: 612792
• UniProt ID: P48651