Recombinant Human PSRC1, GST-tagged

• Cat.No.: PSRC1-39H
• Product Overview: Recombinant Human PSRC1(1 a.a. - 333 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a proline-rich protein that is a target for regulation by the tumor suppressor protein p53. The encoded protein plays an important role in mitosis by recruiting and regulating microtubule depolymerases that destabalize microtubules. Alternatively spliced transcript variants encoding different isoforms have been described.
• Molecular Mass: 62 kDa
• AA Sequence: MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLE EILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRS NDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASPPTPIRSVLAPQP STSNSQRLPRPQGAAAKSSSQLPIPSAIPRPASRMPLTSRSVPPGRGALPPDSLSTRKGLPRPSTAGHRVRESGH KVPVSQRLNLPVMGATRSNLQPPRKVAVPGPTR
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PSRC1 proline/serine-rich coiled-coil 1 [ Homo sapiens ]
• Official Symbol: PSRC1
• Synonyms: PSRC1; proline/serine-rich coiled-coil 1; proline/serine-rich coiled-coil protein 1; DDA3; differential display and activated by p53; DDA3; Differential display and activated by p53; FP3214; p53-regulated DDA3; Proline/serine-rich coiled-coil 1; proline/serine-rich coiled-coil protein 1; p53-regulated DDA3; FP3214
• Gene ID: 84722
• mRNA Refseq: NM_032636
• Protein Refseq: NP_116025
• MIM: 613126
• UniProt ID: Q6PGN9
• Chromosome Location: 1p13.3
• Function: microtubule binding; protein binding