Recombinant Human PSME1, His-tagged

• Cat.No.: PSME1-31227TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-250 of Human PSME1 with N terminal His tag, 34kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-250 a.a.
• Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Two transcripts encoding different isoforms have been identified.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 110 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISEL DAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERK KQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQR LKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKV FELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHV GDYRQLVHELDEAEYRDIRLMVMEIRNAYVRRQGQGRG GQRQLSQATHSLTLQARG
• Full Length: Full L.

Gene Information

• Gene Name: PSME1 proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) [ Homo sapiens ]
• Official Symbol: PSME1
• Synonyms: PSME1; proteasome (prosome, macropain) activator subunit 1 (PA28 alpha); proteasome activator complex subunit 1; IFI5111; PA28alpha
• Gene ID: 5720
• mRNA Refseq: NM_006263
• Protein Refseq: NP_006254
• MIM: 600654
• Uniprot ID: Q06323
• Chromosome Location: 14q11.2
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem