Recombinant Human PSMD9, His-tagged

• Cat.No.: PSMD9-26023TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-223 of Human 26S Proteasome with N terminal His tag, 29kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-223 a.a.
• Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 58 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKAN YDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHN IICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAH KEAMSRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQ VDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKPLNVTVIR RGEKHQLRLVPTRWAGKGLLGCNIIPLQR
• Full Length: Full L.

Gene Information

• Gene Name: PSMD9 proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 [ Homo sapiens ]
• Official Symbol: PSMD9
• Synonyms: PSMD9; proteasome (prosome, macropain) 26S subunit, non-ATPase, 9; 26S proteasome non-ATPase regulatory subunit 9; p27; Rpn4
• Gene ID: 5715
• mRNA Refseq: NM_002813
• Protein Refseq: NP_002804
• MIM: 603146
• Uniprot ID: O00233
• Chromosome Location: 12q24.31-q24.32
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: bHLH transcription factor binding; protein binding; transcription coactivator activity