Recombinant Human PSMB9, His-tagged

Cat.No. : PSMB9-30395TH
Product Overview : Recombinant full length Human Proteasome 20S LMP2 with N terminal His tag; 220 amino acids with tag, Predicted MWt 23.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 199 amino acids
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit.
Conjugation : HIS
Molecular Weight : 23.500kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Sequence Similarities : Belongs to the peptidase T1B family.
Gene Name PSMB9 proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) [ Homo sapiens ]
Official Symbol PSMB9
Synonyms PSMB9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); LMP2, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional protease 2); proteasome subunit beta type-9; beta1i; PSMB6i; RING12;
Gene ID 5698
mRNA Refseq NM_002800
Protein Refseq NP_002791
MIM 177045
Uniprot ID P28065
Chromosome Location 6p21.3
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function peptidase activity; protein binding; threonine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PSMB9 Products

Required fields are marked with *

My Review for All PSMB9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon