Recombinant Human PSMB9, His-tagged

• Cat.No.: PSMB9-30395TH
• Product Overview: Recombinant full length Human Proteasome 20S LMP2 with N terminal His tag; 220 amino acids with tag, Predicted MWt 23.5 kDa.

Specification

• Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit.
• Protein length: 199 amino acids
• Conjugation: HIS
• Molecular Weight: 23.500kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
• Sequence Similarities: Belongs to the peptidase T1B family.

Gene Information

• Gene Name: PSMB9 proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) [ Homo sapiens ]
• Official Symbol: PSMB9
• Synonyms: PSMB9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); LMP2, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional protease 2); proteasome subunit beta type-9; beta1i; PSMB6i; RING12
• Gene ID: 5698
• mRNA Refseq: NM_002800
• Protein Refseq: NP_002791
• MIM: 177045
• Uniprot ID: P28065
• Chromosome Location: 6p21.3
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: peptidase activity; protein binding; threonine-type endopeptidase activity