Recombinant Human PSMB7 protein, T7-tagged

Cat.No. : PSMB7-161H
Product Overview : Recombinant human PSMB7 (277 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 277 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQG YIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDL GSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
Purity : >90% by SDS-PAGE
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name PSMB7 proteasome (prosome, macropain) subunit, beta type, 7 [ Homo sapiens ]
Official Symbol PSMB7
Synonyms PSMB7; macropain chain Z; proteasome subunit Z; proteasome subunit alpha; proteasome subunit beta 7;
Gene ID 5695
mRNA Refseq NM_002799
Protein Refseq NP_002790
MIM 604030
UniProt ID Q99436
Chromosome Location 9q34.11-q34.12
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of NF-kappaB in B Cells, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem;
Function peptidase activity; protein binding; threonine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PSMB7 Products

Required fields are marked with *

My Review for All PSMB7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon