Recombinant Human PSMB7 protein, T7-tagged
Cat.No. : | PSMB7-161H |
Product Overview : | Recombinant human PSMB7 (277 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 277 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQG YIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDL GSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | PSMB7 proteasome (prosome, macropain) subunit, beta type, 7 [ Homo sapiens ] |
Official Symbol | PSMB7 |
Synonyms | PSMB7; macropain chain Z; proteasome subunit Z; proteasome subunit alpha; proteasome subunit beta 7; |
Gene ID | 5695 |
mRNA Refseq | NM_002799 |
Protein Refseq | NP_002790 |
MIM | 604030 |
UniProt ID | Q99436 |
Chromosome Location | 9q34.11-q34.12 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of NF-kappaB in B Cells, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; |
Function | peptidase activity; protein binding; threonine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
PSMB7-5967C | Recombinant Chicken PSMB7 | +Inquiry |
PSMB7-3479R | Recombinant Rhesus Macaque PSMB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMB7-3661R | Recombinant Rhesus monkey PSMB7 Protein, His-tagged | +Inquiry |
PSMB7-4775R | Recombinant Rat PSMB7 Protein | +Inquiry |
PSMB7-4422Z | Recombinant Zebrafish PSMB7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB7-2769HCL | Recombinant Human PSMB7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSMB7 Products
Required fields are marked with *
My Review for All PSMB7 Products
Required fields are marked with *
0
Inquiry Basket