Recombinant Human PSMB7 protein, T7-tagged

• Cat.No.: PSMB7-161H
• Product Overview: Recombinant human PSMB7 (277 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• ProteinLength: 277 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQG YIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDL GSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: PSMB7 proteasome (prosome, macropain) subunit, beta type, 7 [ Homo sapiens ]
• Official Symbol: PSMB7
• Synonyms: PSMB7; macropain chain Z; proteasome subunit Z; proteasome subunit alpha; proteasome subunit beta 7
• Gene ID: 5695
• mRNA Refseq: NM_002799
• Protein Refseq: NP_002790
• MIM: 604030
• UniProt ID: Q99436
• Chromosome Location: 9q34.11-q34.12
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of NF-kappaB in B Cells, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem
• Function: peptidase activity; protein binding; threonine-type endopeptidase activity